puzzle picture
2007: Large Electron Density Transcription factor
Status: Closed

Summary

Name: 2007: Large Electron Density Transcription factor
Status: Closed
Created: 06/17/2021
Points: 100
Expired: 06/24/2021 - 18:00
Difficulty: Advanced
Description: Fold this Transcription factor (TF) into the electron density map! This puzzle might be tough, as this is a large protein. This electron density map comes from x-ray crystallography experiments, and outlines the shape of the folded protein, so help us determine the structure of this TF by folding it in the electron density! Sequence and additional information in the puzzle comments.
Categories: Electron Density, Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science28,933100
2Anthropic Dreams26,71168
3Beta Folders25,63844
4Void Crushers25,58827
5L'Alliance Francophone25,33716

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Bruno Kestemont 3 4 Go Science28,773100
2Bautho 72 71 Go Science28,00896
3fiendish_ghoul 72 17  26,94591
4Nicm25 72 74  26,88287
5grogar7 41 1 Anthropic Dreams26,71183


Need this puzzle? Log in to download.  

Comments

beta_helix's picture
User offline. Last seen 16 hours 5 min ago. Offline
Joined: 05/09/2008
Groups: None
Additional information

Sequence:
SIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLSPIDSNTFEMNGKALLLLTKEDFRYRS
PHSGDELYELLQHILGGGDLGKKLLEAARAGQDDEVRILMANGADVNATDNDGYTPLHLA
ASNGHLEIVEVLLKNGADVNASDLTGITPLHAAAATGHLEIVEVLLKHGADVNAYDNDGH
TPLHLAAKYGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN

Predicted Secondary Structure and more:
https://zhanglab.dcmb.med.umich.edu/I-TASSER/output/S624635/
(We are using the ZhangServer's Model1)

frood66's picture
User is online Online
Joined: 09/20/2011
Groups: Marvin's bunch
if it's that tough

how about 2 weeks? just a thought.

beta_helix's picture
User offline. Last seen 16 hours 5 min ago. Offline
Joined: 05/09/2008
Groups: None
This puzzle has only 1 model, though

We could extend this, if needed, but the reason we did so last time was because we gave you 5 different starting models (and we wanted you to try out each of them).

There is only 1 model this time, so the only "difficultly" is the length: 235 residues might get a bit slow.

Please let us know what you all think after playing it for a day...

frood66's picture
User is online Online
Joined: 09/20/2011
Groups: Marvin's bunch
thx beta helix

I can only assume that U R suggesting the starting (Zhang) layout is near correct.

that being the case....I will spend little (if any) time on this puzzle.

waste of time imao.

and this is from a long term player who particularly likes ED.

sorry

this place costs enough in machine power.....and kills machines quickly.

I'll not waste my time.

All the best ! :)

beta_helix's picture
User offline. Last seen 16 hours 5 min ago. Offline
Joined: 05/09/2008
Groups: None
No need to apologize

You can work on any puzzle you like, frood66!

Last time we gave you 5 models and no density.
This time we only have you 1 model because we provide you with density.

I hope this clears it up.

frood66's picture
User is online Online
Joined: 09/20/2011
Groups: Marvin's bunch
response

I have not played it...so who's the loser there?

give it 14 days...yr excuse is not of much value.

I love ED - it is my fave puzzle....I will always spend loads of time on it when the timescale and definition is of value.

Alas - not this time.

I'll look when it is reposted - cause it will be if it's of any value.

So yes BH - u cleared that up - not at all

beta_helix's picture
User offline. Last seen 16 hours 5 min ago. Offline
Joined: 05/09/2008
Groups: None
"just a thought" ?

You stated in your first post:
"how about 2 weeks? just a thought."
which sounded like a suggestion, not a request, nor an ultimatum.

Please be clear if you are asking for something, rather than just casually providing "just a thought".

It's a bit late to have an argument about this 2 days before the puzzle closes.
You posted your first comment the day the puzzle was released, and I replied the same day.
Next time I would suggest being upfront from the start, rather than waiting until 4 days later to bring this up again (when it's too late).

just a thought.

frood66's picture
User is online Online
Joined: 09/20/2011
Groups: Marvin's bunch
Hmm

I thinkI was up front....right at the start...so what ARE u talking about?

I will add.....some years ago it was agreed by FC that all ED puzzles would state the definition....the Angstrom definition.

What happened to that promise?

please don't try to belittle me when others watch...u dig a pit.

can we get this sort of puzzle on a decent grounding please?

yes - u think I am being difficult - no - I am not.......just pointing stuff out.

Live with what U have promised.....appear sensible and proactive....players here will appreciate that.

Don't shoot the messenger.......I'm more or less the only one left that is prepared to call a spade a spade.

But I DO thank U for yr responses.....it makes a change.

frood

beta_helix's picture
User offline. Last seen 16 hours 5 min ago. Offline
Joined: 05/09/2008
Groups: None
"what are U talking about?"

You make a lot of claims, frood66... and seem very passionate about those statements.

You have declared yourself the messenger (although I have never heard any other players bring any of these claims up)
so I will ask YOUR same question to you:

"what ARE u talking about?"

I have been part of FC since 2008 and do not recall any "promises" made about ED puzzles.

So please, rather than belittling FC, please show me where FC promised your claims.
This is your chance to make me look like a fool in the pit that I dug, so enjoy it!

frood66's picture
User is online Online
Joined: 09/20/2011
Groups: Marvin's bunch
U need to remember my

U need to remember my friend...fc clearly said they would state angstrom definition for ED's.

Not my prob if U cannot remember

with best best wishes

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons