puzzle picture
2004: Revisiting Puzzle 67: Integrase
Status: Closed

Summary

Name: 2004: Revisiting Puzzle 67: Integrase
Status: Closed
Created: 06/10/2021
Points: 100
Expired: 06/17/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams10,529100
2Beta Folders10,50377
3Contenders10,45558
4Go Science10,44043
5Marvin's bunch10,37231

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons