puzzle picture
2001: Revisiting Puzzle 66: Cytochrome
Status: Closed

Summary

Name: 2001: Revisiting Puzzle 66: Cytochrome
Status: Closed
Created: 06/03/2021
Points: 100
Expired: 06/10/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,247100
2Go Science10,24570
3Anthropic Dreams10,23747
4Gargleblasters10,22330
5Contenders10,18719

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1sallallami 71 5  10,253100
2mirp 7 8 Go Science10,24597
3Phyx 47 22 Go Science10,24194
4Bruno Kestemont 3 4 Go Science10,24190
5LociOiling 4 2 Beta Folders10,23987


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 8 hours 56 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
shiny
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons