puzzle picture
1993: Revisiting Puzzle 64: Thioredoxin
Status: Closed

Summary

Name: 1993: Revisiting Puzzle 64: Thioredoxin
Status: Closed
Created: 05/13/2021
Points: 100
Expired: 05/20/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science11,805100
2Anthropic Dreams11,79474
3Beta Folders11,78354
4Marvin's bunch11,70138
5L'Alliance Francophone11,69127

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Bruno Kestemont 1 4 Go Science11,804100
2Galaxie 2 3 Anthropic Dreams11,79497
3LociOiling 4 1 Beta Folders11,78394
4guineapig 44 32  11,74291
5dcrwheeler 67 6  11,73788


Need this puzzle? Log in to download.  

Comments

No comments yet.
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons