puzzle picture
1987: Revisiting Puzzle 63: Spinach Protein
Status: Closed

Summary

Name: 1987: Revisiting Puzzle 63: Spinach Protein
Status: Closed
Created: 04/29/2021
Points: 100
Expired: 05/06/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders11,218100
2Anthropic Dreams11,14073
3Marvin's bunch11,11352
4Contenders11,07936
5L'Alliance Francophone11,05324

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1LociOiling 7 3 Beta Folders11,218100
2grogar7 42 2 Anthropic Dreams11,14098
3johnmitch 83 11  11,11495
4frood66 41 10 Marvin's bunch11,11292
5fiendish_ghoul 83 7  11,09190


Need this puzzle? Log in to download.  

Comments

No comments yet.
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons