puzzle picture
1975: Revisiting Puzzle 60: Beta Barrel
Status: Closed

Summary

Name: 1975: Revisiting Puzzle 60: Beta Barrel
Status: Closed
Created: 04/01/2021
Points: 100
Expired: 04/08/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders12,819100
2Marvin's bunch12,61676
3Go Science12,45556
4Anthropic Dreams12,44941
5Contenders12,42129

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 1 hour 33 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
in beta
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons