puzzle picture
1972: CMG2 with Density
Status: Closed

Summary

Name: 1972: CMG2 with Density
Status: Closed
Created: 03/25/2021
Points: 100
Expired: 04/01/2021 - 18:00
Difficulty: Advanced
Description: Fold this CMG2 protein into the electron density map! This protein is a domain of the human capillary morphogenesis protein 2 (CMG2). The CMG2 protein normally associates with other proteins in connective tissue, and is thought to be important for the formation of new blood vessels. But CMG2 is also targeted by the anthrax toxin, and has been implicated in certain types of cancer. The protein in this puzzle is a variant of CMG2 that researchers are studying to better understand its structure and function. This electron density map comes from x-ray crystallography experiments, and outlines the shape of the folded protein. Help us determine the structure of this CMG2 variant by folding it in the electron density!

Sequence:
SARRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYAVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQS
Categories: Electron Density, Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science17,522100
2Marvin's bunch14,85970
3Beta Folders14,12747
4Contenders14,09330
5L'Alliance Francophone13,77219

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1fiendish_ghoul 78 10  17,837100
2Bautho 65 43 Go Science17,52296
3frood66 41 7 Marvin's bunch14,23292
4LociOiling 6 2 Beta Folders14,10388
5infjamc 35 27 Contenders14,00584


Need this puzzle? Log in to download.  

Comments

spmm's picture
User offline. Last seen 2 weeks 6 days ago. Offline
Joined: 08/05/2010
Groups: Void Crushers
No player or soloist list as

No player or soloist list as yet?

beta_helix's picture
User offline. Last seen 12 hours 5 min ago. Offline
Joined: 05/09/2008
Groups: None
Thanks

Thank you for reporting this, and sorry for the delay.
This has been fixed!

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons