puzzle picture
1970: Revisiting Puzzle 59: TCR Binding Protein
Status: Closed

Summary

Name: 1970: Revisiting Puzzle 59: TCR Binding Protein
Status: Closed
Created: 03/18/2021
Points: 100
Expired: 03/25/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science10,135100
2Anthropic Dreams10,13371
3L'Alliance Francophone10,01549
4Beta Folders10,00933
5Marvin's bunch10,00322

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Galaxie 4 4 Anthropic Dreams10,131100
2g_b 70 47  10,12697
3Phyx 46 26 Go Science10,11794
4ichwilldiesennamen 27 28 Go Science10,10891
5akaaka 70 16  10,10788


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 30 min 5 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
T-cell receptor
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons