puzzle picture
1961: Revisiting Puzzle 57: Beta-Neurotoxin
Status: Closed

Summary

Name: 1961: Revisiting Puzzle 57: Beta-Neurotoxin
Status: Closed
Created: 02/25/2021
Points: 100
Expired: 03/04/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Marvin's bunch10,623100
2Beta Folders10,53880
3Anthropic Dreams10,47463
4Go Science10,45249
5L'Alliance Francophone10,40037

Top Evolvers

RankPlayerGroupScorePoints
1fpc 14 58 Marvin's bunch10,623100
2jausmh 17 35 Marvin's bunch10,59198
3MicElephant 49 33  10,54395
4Angus 24 70 Beta Folders10,52892
5Galaxie 2 3 Anthropic Dreams10,47090

Top Soloists

RankPlayerGroupScorePoints
1Aubade01 70 53  10,566100
2frood66 44 15 Marvin's bunch10,56498
3MicElephant 49 33  10,54495
4fiendish_ghoul 70 16  10,53992
5LociOiling 4 1 Beta Folders10,53890


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 1 hour 35 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
knottin special
APPAAP's picture
User offline. Last seen 8 weeks 5 days ago. Offline
Joined: 04/25/2020
Groups: None
New version comments

Does anyone has notice stability problems with this version? I had several breakdowns and needed to restart it many times. I use Windows 7 Home premium 64-bit. Also in the Rama map when I select a residue it is not noticed-marked, although in the protein the residue has a noticed change.

LociOiling's picture
User offline. Last seen 1 hour 35 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
the Rama map still has problems in the current version

The first selected segment isn't highlighted on the Rama map, which is confusing. The devs are aware of the issue and are working on a fix.

In the selection interface, a workaround for seeing a specific segment is to first select any other segment, then select the segment you want. The segment you want will be highlighted with a white box on the Rama map. If you de-select the first segment, your segment loses the highlight. So you have to remember its position if you want to move by itself.

milkshake's picture
User offline. Last seen 3 weeks 2 days ago. Offline
Joined: 07/17/2019
Groups: Foldit Staff
Thanks APPAAP and Loci. Yes,

Thanks APPAAP and Loci. Yes, as Loci says, we are working on publishing a fix to this ASAP.

APPAAP's picture
User offline. Last seen 8 weeks 5 days ago. Offline
Joined: 04/25/2020
Groups: None
I downloaded and installed

I downloaded and installed Foldit 20210222-46aaceaf66-win_x86
but problem persists. When I login and open the puzzle my score says 9415 and Objective bonus +500 but a little bit later windows reports Foldit.exe has stopped working Close program. I didn't save this one pose in the past.

milkshake's picture
User offline. Last seen 3 weeks 2 days ago. Offline
Joined: 07/17/2019
Groups: Foldit Staff
Hi APPAAP, is there enough

Hi APPAAP, is there enough time to click the "share with scientists" button? I would like to investigate your crash but I am not experiencing any crashes on puzzle 1961. Thank you.

APPAAP's picture
User offline. Last seen 8 weeks 5 days ago. Offline
Joined: 04/25/2020
Groups: None
Where is the "share with

Where is the "share with scientist" button? When logged in I cannot get to the puzzle as soloist.
Can do that from the foldit portal site?
I will try to attach a png image of my laptop screen. Foldit works fine when I am not logged in, as an evolver but when I logged in it tries to get the last saved best score which seems to be problematic. May need to erase some file?

APPAAP's picture
User offline. Last seen 8 weeks 5 days ago. Offline
Joined: 04/25/2020
Groups: None
Everything is working now.

I disabled all autosave and last quicksave file solutions from foldit default folder (soloist). Then logged in without a problem as a soloist at initial possition (start). Last loaded a saved evolver solution and working on it.

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons