puzzle picture
1955: Revisiting Puzzle 55: Scorpion Toxin
Status: Closed

Summary

Name: 1955: Revisiting Puzzle 55: Scorpion Toxin
Status: Closed
Created: 02/11/2021
Points: 100
Expired: 02/18/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence:
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
16Coastal Biochemistry7,3661
17Foldit Staff5,4781

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
16silent gene 46 494 Go Science10,38059
17Phyx 46 203 Go Science10,37757
18NinjaGreg 25 19 Go Science10,34955
19Enzyme 46 188 Gargleblasters10,34353
20MicElephant 8 15  10,31151


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 30 min 43 sec ago. Offline
Joined: 12/27/2012
toxic workplace
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons