puzzle picture

1955: Revisiting Puzzle 55: Scorpion Toxin

Status: Closed

Summary

Name:	1955: Revisiting Puzzle 55: Scorpion Toxin
Status:	Closed
Created:	02/11/2021
Points:	100
Expired:	02/18/2021 - 18:00
Difficulty:	Novice
Description:	This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant. Sequence: VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
16	Coastal Biochemistry	7,366	1
17	Foldit Staff	5,478	1

Show all >

Top Evolvers

Rank	Player	Group	Score	Points
16	puxatudo 46 1295	Go Science	10,541	59
17	Norrjane 46 422	Go Science	10,541	57
18	equilibria 28 99	Go Science	10,540	55
19	sciencewalker 46 1295	Go Science	10,540	53
20	OWM3 46 1295	Gargleblasters	10,538	51

Show all >

Top Soloists

Rank	Player	Group	Score	Points
16	silent gene 46 494	Go Science	10,380	59
17	Phyx 46 203	Go Science	10,377	57
18	NinjaGreg 25 19	Go Science	10,349	55
19	Enzyme 46 188	Gargleblasters	10,343	53
20	MicElephant 8 15		10,311	51

Show all >

Need this puzzle? Log in to download.

Comments

Sat, 02/13/2021 - 19:24

#151

LociOiling's picture

Offline

Joined: 12/27/2012

Groups: Anthropic Dreams

toxic workplace

https://foldit.fandom.com/wiki/Revisiting_puzzle/55:_Scorpion_Toxin


	User login Username: * Password: * Create new account Request new password

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.


	Social Media


	Search Only search fold.it


	Click here to read Foldit's statement on the Black Lives Matter movement.


	Other Games: Mozak

Recommend Foldit


	Topics
	Forums temporarily locked due to spam Happy few Gold players in History Interview with DeepMind's Demis Hassabis timing for "share with scientists"? extend deadline for AlphaFold submissions?


	Top New Users Jai2006 Benjamin_F Abbastanji fracata Zhang Ruichong

Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons