puzzle picture
1946: Revisiting Puzzle 52: Bacteria Energy
Status: Closed

Summary

Name: 1946: Revisiting Puzzle 52: Bacteria Energy
Status: Closed
Created: 01/20/2021
Points: 100
Expired: 01/28/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders11,575100
2Anthropic Dreams11,56074
3Gargleblasters11,43954
4Go Science11,43638
5L'Alliance Francophone11,34127

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 1 hour 58 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
here we go again

We're back to the beginning of the revisiting puzzle series.

https://foldit.fandom.com/wiki/Revisiting_puzzle/52:_Bacteria_Energy

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons