Summary

Name:	1943: Revisiting Puzzle 165: Rosetta Model 15
Status:	Closed
Created:	01/13/2021
Points:	100
Expired:	01/21/2021 - 18:00
Difficulty:	Novice
Description:	This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant. Sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Beta Folders	11,895	100
2	Go Science	11,794	68
3	Anthropic Dreams	11,779	44
4	Contenders	11,645	27
5	Gargleblasters	11,441	16

Rank	Player	Group	Score	Points
1	Angus 18 40	Beta Folders	11,876	100
2	LociOiling 9 5	Beta Folders	11,871	97
3	mirp 1 8	Go Science	11,787	93
4	toshiue 8 155	Go Science	11,786	89
5	Dhalion 3 98	Go Science	11,786	86

Rank	Player	Group	Score	Points
1	LociOiling 9 5	Beta Folders	11,895	100
2	ZeroLeak7 17 1	Go Science	11,794	97
3	grogar7 54 4	Anthropic Dreams	11,779	93
4	mirp 1 8	Go Science	11,495	89
5	Enzyme 52 3	Gargleblasters	11,441	86

Need this puzzle? Log in to download.

Thu, 01/14/2021 - 19:08

Offline

Joined: 03/08/2012

Groups: None

Wrong disulfide count

Puzzle 1943 - Wrong disulfide count -
Usually two(2) disulfide bridges gives 500 points; i'm getting only 250 points -> replacing Puzzle to 1943b?

Fri, 01/15/2021 - 05:53

Offline

Joined: 12/27/2012

Groups: Beta Folders

quinze

This puzzle has four cysteines, but only two are expected to form a disulfide bridge, so the maximum bonus is 250 points.


	User login Username: * Password: * Create new account Request new password

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)


	Click here to read Foldit's statement on the Black Lives Matter movement.

Recommend Foldit


	Topics
	How guest blogging is benficial? Can I get the Cash app customer service number to request a refund? You Must Need To Know About How Do I Delete My Cash App Account Know About the Reasons Of why is my payment pending on cash app Preferred View Options


	Top New Users LaplaceFox evickers29 kainatparveen Wiz kid dessurem