puzzle picture
1940: Revisiting Puzzle 157: Rosetta Decoy 14
Status: Closed

Summary

Name: 1940: Revisiting Puzzle 157: Rosetta Decoy 14
Status: Closed
Created: 01/06/2021
Points: 100
Expired: 01/14/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence:
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams11,702100
2Beta Folders11,67771
3Go Science11,64249
4Contenders11,52333
5L'Alliance Francophone11,51022

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1grogar7 44 2 Anthropic Dreams11,698100
2LociOiling 6 3 Beta Folders11,67797
3ZeroLeak7 29 17 Go Science11,64294
4dcrwheeler 87 7  11,56891
5mirp 1 6 Go Science11,55388


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 55 min 50 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
quatorze
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons