puzzle picture
1937: Revisiting Puzzle 153: Rosetta Decoy 13
Status: Closed

Summary

Name: 1937: Revisiting Puzzle 153: Rosetta Decoy 13
Status: Closed
Created: 12/30/2020
Points: 100
Expired: 01/07/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders11,622100
2Anthropic Dreams11,61070
3Go Science11,58147
4Gargleblasters11,43330
5L'Alliance Francophone11,41119

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1grogar7 40 1 Anthropic Dreams11,610100
2LociOiling 4 2 Beta Folders11,58597
3ZeroLeak7 71 61 Go Science11,58194
4dcrwheeler 71 6  11,56290
5mirp 9 10 Go Science11,56287


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 10 hours 54 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
lucky 13
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons