puzzle picture
1928: Revisiting Puzzle 147: Rosetta Decoy 10
Status: Closed

Summary

Name: 1928: Revisiting Puzzle 147: Rosetta Decoy 10
Status: Closed
Created: 12/10/2020
Points: 100
Expired: 12/17/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders12,396100
2Anthropic Dreams12,18676
3Gargleblasters12,13256
4Go Science12,10441
5L'Alliance Francophone12,05329

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1LociOiling 4 2 Beta Folders12,396100
2dcrwheeler 71 6  12,30797
3Aubade01 71 55  12,22994
4grogar7 40 1 Anthropic Dreams12,17591
5Enzyme 71 41 Gargleblasters12,13289


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 19 min 15 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
another decoy
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons