|
1925: Revisiting Puzzle 146: Rosetta Decoy 9
Status: Closed
|
Summary
| Name: | 1925: Revisiting Puzzle 146: Rosetta Decoy 9 |
|---|---|
| Status: | Closed |
| Created: | 12/02/2020 |
| Points: | 100 |
| Expired: | 12/10/2020 - 18:00 |
| Difficulty: | Novice |
| Description: | This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.
Sequence:
AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK
|
| Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
https://foldit.fandom.com/wiki/Revisiting_puzzle/146:_Rosetta_Decoy_9