puzzle picture
1884: Refinement Target: R1056
Status: Closed

Summary

Name: 1884: Refinement Target: R1056
Status: Closed
Created: 08/28/2020
Points: 100
Expired: 09/04/2020 - 18:00
Difficulty: Novice
Description: CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!

Sequence:
MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams12,653100
2Hold My Beer12,60673
3Beta Folders12,55952
4Go Science12,46436
5Gargleblasters12,41224

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Steven Pletsch 81 96 Hold My Beer12,60497
2LociOiling 8 1 Beta Folders12,55994
3malphis 102 8  12,51591
4Phyx 50 14 Go Science12,45288
5Aubade01 102 68  12,44786


Need this puzzle? Log in to download.  

Comments

No comments yet.
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons