![]() |
1884: Refinement Target: R1056
Status: Closed
|
Summary
Name: | 1884: Refinement Target: R1056 |
---|---|
Status: | Closed |
Created: | 08/28/2020 |
Points: | 100 |
Expired: | 09/04/2020 - 18:00 |
Difficulty: | Novice |
Description: | CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!
Sequence:
MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ |
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.