puzzle picture
1881: Refinement Target: R1068
Status: Closed

Summary

Name: 1881: Refinement Target: R1068
Status: Closed
Created: 08/21/2020
Points: 100
Expired: 08/28/2020 - 18:00
Difficulty: Novice
Description: CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!

Sequence:
QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams12,990100
2Go Science12,70670
3Void Crushers12,45447
4L'Alliance Francophone12,45330
5Beta Folders12,32719

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1grogar7 89 4 Anthropic Dreams12,990100
2mirp 1 2 Go Science12,64097
3Xartos 20 21 Go Science12,59994
4malphis 102 8  12,50091
5spmm 100 30 Void Crushers12,45488


Need this puzzle? Log in to download.  

Comments

No comments yet.
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons