puzzle picture
1881: Refinement Target: R1068
Status: Closed

Summary

Name: 1881: Refinement Target: R1068
Status: Closed
Created: 08/21/2020
Points: 100
Expired: 08/28/2020 - 18:00
Difficulty: Novice
Description: CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!

Sequence:
QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams12,990100
2Go Science12,70670
3Void Crushers12,45447
4L'Alliance Francophone12,45330
5Beta Folders12,32719

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1grogar7 38 2 Anthropic Dreams12,990100
2mirp 13 20 Go Science12,64097
3Xartos 70 1873 Go Science12,59994
4malphis 70 1873  12,50091
5spmm 70 1873 Void Crushers12,45488


Need this puzzle? Log in to download.  

Comments

No comments yet.
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons