puzzle picture
1878: Refinement Puzzle: R1034
Status: Closed

Summary

Name: 1878: Refinement Puzzle: R1034
Status: Closed
Created: 08/13/2020
Points: 100
Expired: 08/21/2020 - 18:00
Difficulty: Novice
Description: CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!

Sequence:
LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science12,515100
2Anthropic Dreams12,50171
3Beta Folders12,38349
4Hold My Beer12,32533
5Gargleblasters12,31022

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Waya 21 7 Anthropic Dreams12,501100
2Xartos 20 21 Go Science12,47997
3grogar7 89 4 Anthropic Dreams12,46994
4g_b 102 16  12,43491
5ZeroLeak7 60 24 Go Science12,39688


Need this puzzle? Log in to download.  

Comments

No comments yet.
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons