puzzle picture
1875: Refinement Puzzle: R1055
Status: Closed

Summary

Name: 1875: Refinement Puzzle: R1055
Status: Closed
Created: 08/07/2020
Points: 100
Expired: 08/14/2020 - 23:00
Difficulty: Novice
Description: CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!

Sequence:
GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams11,553100
2Beta Folders11,49473
3L'Alliance Francophone11,48852
4Go Science11,46436
5Contenders11,43824

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons