puzzle picture
1872: Refinement Puzzle: R1074
Status: Active

Summary

Name: 1872: Refinement Puzzle: R1074
Status: Active
Created: 07/31/2020
Points: 100
Expires: 08/07/2020 - 18:00
Difficulty: Novice
Description: THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!

Sequence:
NDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVSTSSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science11,993
2L'Alliance Francophone11,856
3Anthropic Dreams11,838
4Beta Folders11,829
5Contenders11,821

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons