puzzle picture
1872: Refinement Puzzle: R1074
Status: Closed

Summary

Name: 1872: Refinement Puzzle: R1074
Status: Closed
Created: 07/31/2020
Points: 100
Expired: 08/07/2020 - 18:00
Difficulty: Novice
Description: THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!

Sequence:
NDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVSTSSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science12,035100
2Anthropic Dreams11,91971
3Contenders11,89649
4L'Alliance Francophone11,85633
5Beta Folders11,85022

Top Evolvers

RankPlayerGroupScorePoints
1ZeroLeak7 44 8 Go Science12,033100
2Dhalion 7 83 Go Science12,02597
3Czim 8 79 Go Science12,02095
4mirp 1 3 Go Science12,01792
5Xartos 30 38 Go Science12,01689

Top Soloists

RankPlayerGroupScorePoints
1Phyx 58 21 Go Science12,035100
2malphis 102 10  11,98797
3ZeroLeak7 44 8 Go Science11,98095
4Galaxie 4 7 Anthropic Dreams11,90292
5Bletchley Park 12 34 Contenders11,89689


Need this puzzle? Log in to download.  

Comments

No comments yet.
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons