![]() |
1872: Refinement Puzzle: R1074
Status: Closed
|
Summary
Name: | 1872: Refinement Puzzle: R1074 |
---|---|
Status: | Closed |
Created: | 07/31/2020 |
Points: | 100 |
Expired: | 08/07/2020 - 18:00 |
Difficulty: | Novice |
Description: | THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts! Sequence:
NDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVSTSSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.