puzzle picture
1869: Refinement Puzzle: R1049
Status: Closed

Summary

Name: 1869: Refinement Puzzle: R1049
Status: Closed
Created: 07/24/2020
Points: 100
Expired: 07/31/2020 - 18:00
Difficulty: Novice
Description: CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!

Sequence:
SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders11,477100
2Go Science11,39277
3Anthropic Dreams11,30258
4L'Alliance Francophone11,18543
5Marvin's bunch11,13131

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1LociOiling 8 1 Beta Folders11,477100
2malphis 152 42  11,38798
3Aubade01 152 89  11,34295
4ZeroLeak7 33 6 Go Science11,31392
5Phyx 38 8 Go Science11,26689


Need this puzzle? Log in to download.  

Comments

No comments yet.
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons