puzzle picture
1860: Refinement Puzzle: R1040
Status: Closed

Summary

Name: 1860: Refinement Puzzle: R1040
Status: Closed
Created: 07/02/2020
Points: 100
Expired: 07/10/2020 - 18:00
Difficulty: Intermediate
Description: THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released this refinement target, but this time with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds could be far from both starts!

Sequence:
PNFKVEHTKKSFKLAKDYIAQNEITVEEMYDELEDHGFNIDDIANGEEVTESAITEAFIKNHILNSNSELEYHNDFVKQHNIDAVNKIDFLGYSEELHKNKSEQLQNRLFDLYWAVLTNEKTYGDLITPI
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science11,867100
2Beta Folders11,85177
3L'Alliance Francophone11,76758
4Anthropic Dreams11,72943
5Contenders11,67531

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

puxatudo's picture
User offline. Last seen 1 day 19 hours ago. Offline
Joined: 04/07/2014
Groups: Go Science
PSIPRED Info

Loads of information here. I hope it's useful.
Server from "UCL Department of Computer Science: Bioinformatics Group"
(http://bioinf.cs.ucl.ac.uk/psipred/)

R1040

http://bioinf.cs.ucl.ac.uk/psipred/&uuid=5d5117c2-be13-11ea-8813-00163e100d53

Joined: 05/09/2008
Groups: None
Thanks, but beware!

Just note that the servers that produced these CASP predictions also used PSIPRED (and more), yet ended up with these incorrect solutions.

While I doubt the native has the exact opposite of these PSIPRED predictions, it is very unlikely that it follows them perfectly!

Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons