1851: Revisiting Puzzle 134: Rice

Status: Closed

Summary

Name:	1851: Revisiting Puzzle 134: Rice
Status:	Closed
Created:	06/12/2020
Points:	100
Expired:	06/19/2020 - 18:00
Difficulty:	Intermediate
Description:	This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant. Sequence: AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Gargleblasters	10,785	100
2	Go Science	10,734	78
3	Anthropic Dreams	10,673	60
4	Contenders	10,550	45
5	L'Alliance Francophone	10,448	33

Rank	Player	Group	Score	Points
1	Pazithi 70 382	Gargleblasters	10,785	100
2	Blipperman 70 175	Gargleblasters	10,784	98
3	ManVsYard 18 151	Gargleblasters	10,769	95
4	Mike Lewis 70 1873	Gargleblasters	10,769	93
5	Jpilkington 70 1873	Gargleblasters	10,750	90

Rank	Player	Group	Score	Points
1	Migi 70 1873	Gargleblasters	10,767	100
2	Xartos 70 1873	Go Science	10,716	98
3	KarenCH 70 1873	Anthropic Dreams	10,622	95
4	johnmitch 70 14		10,620	93
5	robgee 8 10	Anthropic Dreams	10,569	90

Need this puzzle? Log in to download.

Sat, 06/13/2020 - 03:07

Offline

Joined: 12/27/2012

Groups: Beta Folders

rice pudding

Wed, 06/17/2020 - 23:39

Offline

Joined: 04/20/2012

Groups: Go Science

105 ways to make 4 disulfides from 8 cysteines

https://fold.it/portal/recipe/43861#comment-28861
says there are 105 different ways to make
4 disulfide bonds from 8 cysteines.

Thu, 06/18/2020 - 18:47

Offline

Joined: 04/30/2020

Groups: None

But if you use DiANNA or

But if you use DiANNA or DISILFIND they only predict 4. But not the same ones!!


	User login Username: * Password: * Create new account Request new password

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)


	Click here to read Foldit's statement on the Black Lives Matter movement.

Recommend Foldit


	Topics
	DeepMind's Demis Hassabis, John Jumper lecture on AlphaFold Foldit Newsletters Foldit malfunction on Linux search script How to interpret AlphaFold structures


	Top New Users HOCKA21 drwhoknows kudka21 miguelito123 sed4906