puzzle picture
1851: Revisiting Puzzle 134: Rice
Status: Closed

Summary

Name: 1851: Revisiting Puzzle 134: Rice
Status: Closed
Created: 06/12/2020
Points: 100
Expired: 06/19/2020 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence:
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Gargleblasters10,785100
2Go Science10,73478
3Anthropic Dreams10,67360
4Contenders10,55045
5L'Alliance Francophone10,44833

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 7 hours 46 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
rice pudding
jeff101's picture
User offline. Last seen 15 hours 27 min ago. Offline
Joined: 04/20/2012
Groups: Go Science
105 ways to make 4 disulfides from 8 cysteines

https://fold.it/portal/recipe/43861#comment-28861
says there are 105 different ways to make
4 disulfide bonds from 8 cysteines.

Joined: 04/30/2020
Groups: None
But if you use DiANNA or

But if you use DiANNA or DISILFIND they only predict 4. But not the same ones!!

Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons