1851: Revisiting Puzzle 134: Rice

Status: Closed

Summary

Name:	1851: Revisiting Puzzle 134: Rice
Status:	Closed
Created:	06/12/2020
Points:	100
Expired:	06/19/2020 - 18:00
Difficulty:	Intermediate
Description:	This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant. Sequence: AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Gargleblasters	10,785	100
2	Go Science	10,734	78
3	Anthropic Dreams	10,673	60
4	Contenders	10,550	45
5	L'Alliance Francophone	10,448	33

Rank	Player	Group	Score	Points
1	Pazithi 26 24	Gargleblasters	10,785	100
2	Blipperman 24 39	Gargleblasters	10,784	98
3	ManVsYard 66 461	Gargleblasters	10,769	95
4	Mike Lewis 16 25	Gargleblasters	10,769	93
5	Jpilkington 12 70	Gargleblasters	10,750	90

Rank	Player	Group	Score	Points
1	Migi 66 75	Gargleblasters	10,767	100
2	Xartos 19 15	Go Science	10,716	98
3	KarenCH 61 59	Anthropic Dreams	10,622	95
4	johnmitch 109 20		10,620	93
5	robgee 13 26	Anthropic Dreams	10,569	90

Need this puzzle? Log in to download.

Sat, 06/13/2020 - 03:07

Offline

Joined: 12/27/2012

Groups: Beta Folders

rice pudding

Wed, 06/17/2020 - 23:39

Offline

Joined: 04/20/2012

Groups: Go Science

105 ways to make 4 disulfides from 8 cysteines

https://fold.it/portal/recipe/43861#comment-28861
says there are 105 different ways to make
4 disulfide bonds from 8 cysteines.

Thu, 06/18/2020 - 18:47

Offline

Joined: 04/30/2020

Groups: None

But if you use DiANNA or

But if you use DiANNA or DISILFIND they only predict 4. But not the same ones!!

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)


	Click here to read Foldit's statement on the Black Lives Matter movement.

Recommend Foldit


	User login Username: * Password: * Create new account Request new password


	Topics
	Fold it researchers/reviewers wanted for German public TV Saving a solution to another computer Metrics on older Puzzles and Organization of Save Files Office Hours Foldit Office Hours Feedback


	Top New Users tgor5701 Animez Ianishere DevL ClaSybF20