1851: Revisiting Puzzle 134: Rice

Status: Closed

Summary

Name:	1851: Revisiting Puzzle 134: Rice
Status:	Closed
Created:	06/12/2020
Points:	100
Expired:	06/19/2020 - 18:00
Difficulty:	Intermediate
Description:	This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant. Sequence: AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Gargleblasters	10,785	100
2	Go Science	10,734	78
3	Anthropic Dreams	10,673	60
4	Contenders	10,550	45
5	L'Alliance Francophone	10,448	33

Rank	Player	Group	Score	Points
1	Pazithi 53 110	Gargleblasters	10,785	100
2	Blipperman 23 42	Gargleblasters	10,784	98
3	ManVsYard 36 237	Gargleblasters	10,769	95
4	Mike Lewis 32 37	Gargleblasters	10,769	93
5	Jpilkington 33 260	Gargleblasters	10,750	90

Rank	Player	Group	Score	Points
1	Migi 87 1969	Gargleblasters	10,767	100
2	Xartos 87 1969	Go Science	10,716	98
3	KarenCH 87 1969	Anthropic Dreams	10,622	95
4	johnmitch 87 12		10,620	93
5	robgee 12 18	Anthropic Dreams	10,569	90

Need this puzzle? Log in to download.

Sat, 06/13/2020 - 03:07

Offline

Joined: 12/27/2012

Groups: Beta Folders

rice pudding

Wed, 06/17/2020 - 23:39

Offline

Joined: 04/20/2012

Groups: Go Science

105 ways to make 4 disulfides from 8 cysteines

https://fold.it/portal/recipe/43861#comment-28861
says there are 105 different ways to make
4 disulfide bonds from 8 cysteines.

Thu, 06/18/2020 - 18:47

Offline

Joined: 04/30/2020

Groups: None

But if you use DiANNA or

But if you use DiANNA or DISILFIND they only predict 4. But not the same ones!!


	User login Username: * Password: * Create new account Request new password

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)


	Click here to read Foldit's statement on the Black Lives Matter movement.

Recommend Foldit


	Topics
	Foldit Newsletters Chat server unavailable. What is a scientifically valuable solution in symmetric puzzles? Game Researchers Need Your Help What is the best computer for folding ?


	Top New Users Jibster ExNihilus PigeonBar schomk22 41921240