Summary

Name:	1845: Revisiting Puzzle 125: Ice Binding Protein
Status:	Closed
Created:	05/28/2020
Points:	100
Expired:	06/05/2020 - 18:00
Difficulty:	Novice
Description:	This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Sequence: ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Go Science	10,241	100
2	Contenders	10,207	74
3	Anthropic Dreams	10,184	54
4	Beta Folders	10,162	38
5	L'Alliance Francophone	10,125	27

Rank	Player	Group	Score	Points
1	Bruno Kestemont 2 4	Go Science	10,241	100
2	Galaxie 4 5	Anthropic Dreams	10,184	98
3	LociOiling 6 3	Beta Folders	10,159	96
4	pente_player 87 1969	Go Science	10,149	94
5	puxatudo 56 755	Go Science	10,144	91

Rank	Player	Group	Score	Points
1	Bletchley Park 13 40	Contenders	10,207	100
2	grogar7 44 2	Anthropic Dreams	10,179	98
3	Aubade01 87 62		10,179	96
4	LociOiling 6 3	Beta Folders	10,162	94
5	NinjaGreg 24 22	Go Science	10,154	91

Need this puzzle? Log in to download.

Fri, 05/29/2020 - 19:38

Offline

Joined: 12/27/2012

Groups: Beta Folders

fish on ice

Mon, 06/15/2020 - 13:49

Offline

Joined: 06/15/2020

Groups: None

Grateful

Thank you so much for the additional information.


	User login Username: * Password: * Create new account Request new password

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)


	Click here to read Foldit's statement on the Black Lives Matter movement.

Recommend Foldit


	Topics
	Foldit Newsletters Chat server unavailable. What is a scientifically valuable solution in symmetric puzzles? Game Researchers Need Your Help What is the best computer for folding ?


	Top New Users ExNihilus PigeonBar schomk22 41921240 a754396291