|
1845: Revisiting Puzzle 125: Ice Binding Protein
Status: Closed
|
Summary
Name: |
1845: Revisiting Puzzle 125: Ice Binding Protein |
Status: |
Closed |
Created: |
05/28/2020 |
Points: |
100 |
Expired: |
06/05/2020 - 18:00 |
Difficulty: |
Novice |
Description: |
This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.
Sequence:
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
Comments
https://foldit.fandom.com/wiki/Revisiting_puzzle/125:_Ice_Binding