puzzle picture
1844: Coronavirus ORF3a Prediction
Status: Closed

Soloists

RankPlayerGroupScorePoints
126iplfd 78 1936  8,1416
127Evica 78 102  8,1405
128versat82 78 608 Rechenkraft.net8,1285
129TimeDevBlocker 78 1936 Team China8,1255
130vador98 78 1936  8,1245
131rabamino12358 78 403  8,0275
132Joe Haenn 78 1936  7,9805
133philli47 78 1936  7,9174
134hexaguin 78 1936  7,8444
135Mickataef 78 888  7,8434
136hilltopper 78 1936  7,8404
137EmmaLives 78 1936  7,7744
138allie_heather47 78 1936  7,7514
139S0ckrates 78 1936  7,7444
140paja22 78 1936  7,7024
141sciencewalker 21 144 Go Science7,6924
142fsk8r 78 1936  7,6713
143immerdasgleiche 78 1936  7,6593
144pascal ochem 78 158  7,6213
145cobaltteal 78 583  7,6193
146knotartist 78 1936 Marvin's bunch7,5853
147nathalie f... 78 1936  7,5543
148tom2705 78 1936  7,5523
149Trajan464 78 111  7,5503
150lwelite 78 1026  7,5013


Need this puzzle? Log in to download.  

Comments

bkoep's picture
User offline. Last seen 17 hours 55 min ago. Offline
Joined: 11/15/2012
Groups: Foldit Staff
PSIPRED Predictions

Conf: 962248952023898999555885446656789996999839985466210130014604
Pred: CCCCCCCCCCCCCCEEEEEECCCCCEEEECCCCCCEEEEECCCCCCCCCCCCCCCCCCEE
  AA: WKCRSKNPLLYDANYFLCWHTNCYDYCIPYNSVTSSIVITSGDGTTSPISEHDYQIGGYT
              10        20        30        40        50        60


Conf: 113344213899998535773786403210278740588898554368925430788941
Pred: EECCCCCCCEEEEEEECCCCEEEEEECCCCCCCCCCEEEEEEEEECCCCCHHCEEEEEEE
  AA: EKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEPEEHVQIHTID
              70        80        90       100       110       120


Conf: 7988336877533478984002479
Pred: CCCCCCCCCCCCCCCCCCCCCCCCC
  AA: GSSGVVNPVMEPIYDEPTTTTSVPL
             130       140
Joined: 01/19/2019
Groups: Go Science
Routine information

This is presumably the cytoplasmic part of ORF3a (UniProt P59632 for the very similar SARS-Cov-1 version). In line with this environment, no disulfides are expected by DiaNNA.

This thing is somewhat conserved in other betacov genomes; bat versions include A0A088DI21 and A0A1B3Q5V5. Below is an alignment of these guys; you can see the human-infecting SARSr-COVs have some extensions not found in the two bat versions.

>Pz1844
WKCRSKNPLLYDANYFLCWHTN
CYDYCIPYNSVTSSI-VITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDY
YQLYSTQLSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTCT
SVP-
>New|UniRef100_A0A088DI21 Uncharacterized protein n=1 Tax=Bat Hp-betacoronavirus/Zhejiang2013 TaxID=1541205 RepID=A0A088DI21_9BETC
IRCKSLVPLCADDDCFVNYNAG
GKTYCMPFDPNEPYLTLVVHQNGIT---------CGSYKLYGDVSIADRIYLVTLTKSVP
YSLQNI---FDAELCTIAFYIADCAV------IEDHTTAGKTPRLELKSDPIYEVPCATI
DVPL
>New|UniRef100_A0A1B3Q5V5 NS3 protein n=1 Tax=Rousettus bat coronavirus TaxID=1892416 RepID=A0A1B3Q5V5_9BETC
IRVHSMAPFVSTADNFAVLRTT
CSRFVFPVESSKDNVVVLTTSRGVF---------CNGIHVEGPTALSDNASIVSLFSTTV
LLLDRVEQGYDY---TVFVYISQQILRNSE--------SNPQGVVNPEFD----------
DVEL

This probably won't work, but just for the sake of fun I told Rosetta's GREMLIN to try and figure out what residues are changing together. This sort of correlation is usually indicative of close contact in the actual protein. http://openseq.org/sub.php?id=1591034373 The last time GREMLIN tried it was in 2013 without enough sequences to work with, and I don't really see that changing much: http://gremlin.bakerlab.org/pfam.php?id=PF11289&year=2013.

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons