puzzle picture
1841: Coronavirus NSP6 Prediction
Status: Closed

Summary

Name: 1841: Coronavirus NSP6 Prediction
Status: Closed
Created: 05/21/2020
Points: 0
Expired: 05/28/2020 - 23:00
Difficulty: Intermediate
Description: Note: This puzzle was originally posted with an incorrect sequence. It was closed early and replaced by Puzzle 1841b.

Fold this coronavirus protein! This is a portion of a larger protein encoded in the viral genome of SARS-CoV-2. It is encoded in a region of the genome called NSP6, but the protein's structure and function are still unknown. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!

Sequence:
CTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQ
Categories:

Top Groups

RankGroupScorePoints
1Contenders10,4490
2Go Science9,9860
3L'Alliance Francophone9,2500
4Anthropic Dreams9,0050
5Gargleblasters8,9390

Top Evolvers

RankPlayerGroupScorePoints
1puxatudo 24 259 Go Science9,7840
2fisherlr777 22 271 Go Science9,7720

Top Soloists

RankPlayerGroupScorePoints
1infjamc 40 77 Contenders10,4490
2NinjaGreg 14 13 Go Science9,9860
3johnmitch 166 10  9,6990
4ZeroLeak7 20 1 Go Science9,6400
5CAN1958 166 90  9,3920


Need this puzzle? Log in to download.  

Comments

Joined: 03/05/2015
Groups: Gargleblasters
Not the right sequence

Not the right sequence

Susume's picture
User offline. Last seen 48 min 56 sec ago. Offline
Joined: 10/02/2011
Gave us 1835 again

The AA sequence in the game is the same one we had for 1835, an nsp2 domain. The sequence in the puzzle comments is for an nsp6 domain - probably what we were supposed to get.

Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons