puzzle picture
1836: Revisiting Puzzle 115: Exocyst
Status: Closed

Summary

Name: 1836: Revisiting Puzzle 115: Exocyst
Status: Closed
Created: 05/08/2020
Points: 100
Expired: 05/15/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams11,115100
2Go Science11,06681
3Void Crushers11,01164
4Contenders10,98350
5Hold My Beer10,96039

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Tygh 70 1873 Anthropic Dreams11,070100
2dcrwheeler 70 5  11,06699
3Phyx 41 22 Go Science11,05697
4ZeroLeak7 70 65 Go Science11,05695
5mirp 13 20 Go Science11,05393


Need this puzzle? Log in to download.  

Comments

Phyx's picture
User offline. Last seen 8 hours 38 min ago. Offline
Joined: 10/08/2011
Groups: Go Science
The power of Foldit compels you!
NinjaGreg's picture
User offline. Last seen 3 hours 23 min ago. Offline
Joined: 05/21/2010
Groups: Go Science
Weird dialog when opening this ...

It says "Both weights file and score function name supplied.", then hangs with the foldit logo and "Loading". Is this expected?

NinjaGreg's picture
User offline. Last seen 3 hours 23 min ago. Offline
Joined: 05/21/2010
Groups: Go Science
I'm also on Mac.

Also, on the loading screen there's a text in the upper left "No Tool".

bkoep's picture
User offline. Last seen 3 hours 46 min ago. Offline
Joined: 11/15/2012
Groups: Foldit Staff
Fixed

Thanks for the quick feedback! I think we've fixed the problem. At the Puzzle Menu screen, you may have to click Refresh List to make sure your Foldit client gets the fix.

NinjaGreg's picture
User offline. Last seen 3 hours 23 min ago. Offline
Joined: 05/21/2010
Groups: Go Science
Got it!

Thanks for the quick action on that!

g_b's picture
User offline. Last seen 1 day 3 hours ago. Offline
Joined: 04/28/2010
Groups: None
this puzzle isn't loading on ny Mac

get dialog "Both weights file and score function name supplied" with close button. Click Close and screen shows Loading forever.

Joined: 05/03/2009
Groups: Contenders
Yes, Win10 too

same message and hang here as well

Joined: 03/30/2013
Groups: Go Science
Problem resolved here

Had the same pathology as NinjaGreg. Has successfully resolved on my Mac (Yosemite 10.10.5).
Thanks Bkoep.

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons