1836: Revisiting Puzzle 115: Exocyst

Status: Closed

Summary

Name:	1836: Revisiting Puzzle 115: Exocyst
Status:	Closed
Created:	05/08/2020
Points:	100
Expired:	05/15/2020 - 18:00
Difficulty:	Novice
Description:	This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Sequence: HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Anthropic Dreams	11,115	100
2	Go Science	11,066	81
3	Void Crushers	11,011	64
4	Contenders	10,983	50
5	Hold My Beer	10,960	39

Show all >

Top Evolvers

Rank	Player	Group	Score	Points
1	Galaxie 3 5	Anthropic Dreams	11,115	100
2	robgee 8 13	Anthropic Dreams	11,085	99
3	alcor29 5 65	Anthropic Dreams	11,082	97
4	Tygh 110 91	Anthropic Dreams	11,078	95
5	pauldunn 58 85	Go Science	11,066	93

Show all >

Top Soloists

Rank	Player	Group	Score	Points
1	Tygh 110 91	Anthropic Dreams	11,070	100
2	dcrwheeler 172 8		11,066	99
3	Phyx 29 7	Go Science	11,056	97
4	ZeroLeak7 38 6	Go Science	11,056	95
5	mirp 1 3	Go Science	11,053	93

Show all >

Need this puzzle? Log in to download.

Comments

Fri, 05/08/2020 - 22:23

Phyx 29 7

Offline

Joined: 10/08/2011

Groups: Go Science

The power of Foldit compels you!

https://foldit.fandom.com/wiki/Revisiting_puzzle/115:_Exocyst

Fri, 05/08/2020 - 23:05

NinjaGreg 21 12

Offline

Joined: 05/21/2010

Groups: Go Science

Weird dialog when opening this ...

It says "Both weights file and score function name supplied.", then hangs with the foldit logo and "Loading". Is this expected?

Fri, 05/08/2020 - 23:17

NinjaGreg 21 12

Offline

Joined: 05/21/2010

Groups: Go Science

I'm also on Mac.

Also, on the loading screen there's a text in the upper left "No Tool".

Fri, 05/08/2020 - 23:39

bkoep 172 3336

Offline

Joined: 11/15/2012

Groups: Foldit Staff

Fixed

Thanks for the quick feedback! I think we've fixed the problem. At the Puzzle Menu screen, you may have to click Refresh List to make sure your Foldit client gets the fix.

Fri, 05/08/2020 - 23:47

NinjaGreg 21 12

Offline

Joined: 05/21/2010

Groups: Go Science

Got it!

Thanks for the quick action on that!

Fri, 05/08/2020 - 23:06

g_b 172 17

Offline

Joined: 04/28/2010

Groups: None

this puzzle isn't loading on ny Mac

get dialog "Both weights file and score function name supplied" with close button. Click Close and screen shows Loading forever.

Fri, 05/08/2020 - 23:36

CharlieFortsCon... 16 19

Offline

Joined: 05/03/2009

Groups: Contenders

Yes, Win10 too

same message and hang here as well

Sat, 05/09/2020 - 01:18

Anfinsen_slept_here 20 32

Offline

Joined: 03/30/2013

Groups: Go Science

Problem resolved here

Had the same pathology as NinjaGreg. Has successfully resolved on my Mac (Yosemite 10.10.5).
Thanks Bkoep.

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.


	Other Games: Mozak


	Search Only search fold.it

Recommend Foldit


	User login Username: * Password: * Create new account Request new password


	Topics
	online only Create a new experimental script The Hypotheses from Investigating Proteins concerning Oxygen Scripps Study: D614G Mutation Allows Coronavirus to Infect More Cells Mac control, command, and options keys? (Plus any other hotkey lore....)


	Top New Users Moosenger Sforiu kosmo1 BNet felimare

Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons