puzzle picture
1816: Revisiting Puzzle 109: Pumpkin
Status: Closed

Summary

Name: 1816: Revisiting Puzzle 109: Pumpkin
Status: Closed
Created: 03/24/2020
Points: 100
Expired: 04/01/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence:
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,246100
2L'Alliance Francophone9,22081
3Beta Folders9,16264
4Go Science9,13850
5Hun-Magyar Csapat9,06039

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 10 hours 58 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
may turn into a pumpkin a little early

https://foldit.fandom.com/wiki/Revisiting_puzzle/109:_Pumpkin

Like the previous revisiting puzzle, the expiration time on this one is 5 hours later than normal. It's set to expire at 23:00 UTC/GMT, where revisiting puzzles normally expire at 18:00 UTC/GMT.

Puzzle 1813: Revisiting Puzzle 97: Pig was set up the same way, but actually expired at 18:00 UTC, the customary time.

Don't count on the five extra hours! (Sad experience here.)

Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons