puzzle picture
1813: Revisiting Puzzle 97: Pig
Status: Closed

Summary

Name: 1813: Revisiting Puzzle 97: Pig
Status: Closed
Created: 03/18/2020
Points: 100
Expired: 03/25/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams11,074100
2Marvin's bunch11,05183
3Go Science11,04269
4Beta Folders11,02956
5Gargleblasters10,89545

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Phyx's picture
User offline. Last seen 2 days 2 hours ago. Offline
Joined: 10/08/2011
Groups: Go Science
Oink! Oink!
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons