puzzle picture
1807: Revisiting Puzzle 95: Chicken
Status: Closed

Summary

Name: 1807: Revisiting Puzzle 95: Chicken
Status: Closed
Created: 03/03/2020
Points: 100
Expired: 03/11/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,830100
2Anthropic Dreams10,82474
3Go Science10,82054
4Void Crushers10,61238
5L'Alliance Francophone10,55027

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 19 min 17 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
the ghost of mr. chicken
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons