puzzle picture
1801: Revisiting Puzzle 93: Spider Toxin
Status: Closed

Summary

Name: 1801: Revisiting Puzzle 93: Spider Toxin
Status: Closed
Created: 02/18/2020
Points: 100
Expired: 02/26/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence:
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Contenders10,101100
2Go Science9,94574
3Anthropic Dreams9,94154
4Beta Folders9,84938
5L'Alliance Francophone9,77527

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 1 hour 24 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
does whatever a spider can
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons