puzzle picture
1797: CRISPR-Cas Transposase Part II: Electron Density
Status: Closed

Summary

Name: 1797: CRISPR-Cas Transposase Part II: Electron Density
Status: Closed
Created: 02/07/2020
Points: 100
Expired: 02/14/2020 - 23:00
Difficulty: Advanced
Description: Fold the transposase protein into a density map! This is a followup to Puzzle 1787: CRISPR-Cas Transposase Part II, now with a cryo-EM density map! Players may load in previous work from Puzzle 1787.

CRISPR-Cas is a mixed complex of RNA and proteins, which work together to make a very precise cut in a cell's DNA. Scientists recently discovered a variant of CRISPR-Cas that coopts a new protein called a transposase. In addition to cutting DNA, the transposase also allows precise insertion of new material into a target DNA strand. This new variant could lead to more efficient gene editing with CRISPR-Cas! New cryoEM experiments have shed some light on the transposase structure, which was previously unknown.

We're asking Foldit players to help solve how this transposase protein folds! The transposase is a large 400-residue protein, so this puzzle only includes residues from the second half of the protein. Likewise, the provided density corresponds to only this half of the transposase protein.

Sequence:
GHEAACTVSNWLAGHESKPLPNLPKSYRWGLVHWWMGIKDSEFDHFSFVQFFSNWPRSFHSIIEDEVEFNLEHAVVSTSELRLKDLLGRLFFGSIRLPERNLQHNIILGELLCYLENRLWQDKGLIANLKMNALEATVMLNCSLDQIASMVEQRILKPNRKSKPNSPLDVTDYLFHFGDIFCLWLAEFQSDEFNRSFYVSRW
Categories: Electron Density, Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science21,743100
2Beta Folders20,04777
3Hold My Beer18,31258
4Anthropic Dreams18,22143
5Contenders18,17731

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Susume's picture
User offline. Last seen 1 hour 50 min ago. Offline
Joined: 10/02/2011
Weird density

The density on this one is in strange flat layers, like it's been skewed somehow. The parts that do look kinda helixy also look like they have been squashed diagonally.

Batz's picture
User offline. Last seen 3 days 5 hours ago. Offline
Joined: 02/16/2012
Groups: Go Science
High flexibility

That's a problem with cryo-EM. It looks like the transposase is very flexible in the overall map of the CRISPR complex. In the corresponding paper, they write, that they have improved the density by masked refinement, but did not publish the map...

Joined: 09/24/2012
Groups: Go Science
Question

Do we see only half the density to fit half the protein, or do we get the whole cloud ?

bkoep's picture
User offline. Last seen 6 hours 14 min ago. Offline
Joined: 11/15/2012
Groups: None
Half cloud

The density here is only half of the transposase density, corresponding to this half of the transposase sequence.

(Puzzle 1794 included the other half of the density, with the other half of the sequence.)

Joined: 09/24/2012
Groups: Go Science
Puzzle for advanced players

I've the impression that this one is not for advanced players but only for future Nobel prices ;)

jeff101's picture
User offline. Last seen 27 min 58 sec ago. Offline
Joined: 04/20/2012
Groups: Go Science
Sequels to 1784/1794 and 1787/1797 puzzle series

If you make sequels to the puzzle series 1784/1794 or 1787/1797,
please let solutions from all previous puzzles in each series
work in their sequels too. If you give us different ED Clouds,
please keep the same coordinates so that if we positioned protein
parts correctly in the previous puzzles, we won't have to adjust
them in the sequels. Please also copy all ED dots from 1794 and
1797 solutions into these puzzles' sequels so that we won't have
to lay out all these ED dots again.

Thanks!
Jeff

bkoep's picture
User offline. Last seen 6 hours 14 min ago. Offline
Joined: 11/15/2012
Groups: None
We'll do our best!

We'll be sure to allow sharing in sequel puzzles so that you can continue with your previous work! I'm not sure if the ED dots can be transferred from puzzle to puzzle...

Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons