puzzle picture
1795: Revisiting Puzzle 91: Virus Protein
Status: Closed

Summary

Name: 1795: Revisiting Puzzle 91: Virus Protein
Status: Closed
Created: 02/04/2020
Points: 100
Expired: 02/12/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence:
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science10,501100
2Anthropic Dreams10,48877
3Beta Folders10,39458
4Marvin's bunch10,36343
5Gargleblasters10,24431

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Aubade01 127 57  10,539100
2Phyx 20 7 Go Science10,49697
3tyler0911 127 138 Anthropic Dreams10,47594
4dcrwheeler 127 10  10,46992
5Bruno Kestemont 1 2 Go Science10,43589


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 2 hours 40 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
u have virus
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons