puzzle picture
1783: Revisiting Puzzle 87: Zinc Binding Protein
Status: Closed

Summary

Name: 1783: Revisiting Puzzle 87: Zinc Binding Protein
Status: Closed
Created: 01/07/2020
Points: 100
Expired: 01/15/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science9,095100
2Anthropic Dreams9,04574
3Beta Folders9,03354
4Hun-Magyar Csapat9,02138
5Contenders9,00227

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 12/27/2012
Groups: Beta Folders
solid zinc
Joined: 09/24/2012
Groups: Go Science
Thanks !

The wiki gives a really great explanation !

Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons