puzzle picture
1780: Revisiting Puzzle 86: Nematode
Status: Closed

Summary

Name: 1780: Revisiting Puzzle 86: Nematode
Status: Closed
Created: 12/31/2019
Points: 100
Expired: 01/08/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams11,104100
2Go Science11,07974
3L'Alliance Francophone10,97554
4Beta Folders10,95338
5Contenders10,95027

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 3 hours 4 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
tode away

Where do you go when you're tode away?

https://foldit.fandom.com/wiki/Revisiting_puzzle/86:_Nematode

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons