puzzle picture

1771: Revisiting Puzzle 83: Cardiotoxin

Status: Closed

Summary

Name:	1771: Revisiting Puzzle 83: Cardiotoxin
Status:	Closed
Created:	12/10/2019
Points:	100
Expired:	12/18/2019 - 18:00
Difficulty:	Novice
Description:	This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Sequence: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Go Science	10,408	100
2	Beta Folders	10,388	71
3	Void Crushers	10,324	49
4	Anthropic Dreams	10,309	33
5	Marvin's bunch	10,291	22

Show all >

Top Evolvers

Rank	Player	Group	Score	Points
1	silent gene 5 9	Go Science	10,408	100
2	Bruno Kestemont 3 4	Go Science	10,407	96
3	NinjaGreg 19 15	Go Science	10,407	92
4	ZeroLeak7 71 61	Go Science	10,405	89
5	Anfinsen_slept_here 22 50	Go Science	10,404	85

Show all >

Top Soloists

Rank	Player	Group	Score	Points
1	ZeroLeak7 71 61	Go Science	10,396	100
2	NinjaGreg 19 15	Go Science	10,390	96
3	LociOiling 4 2	Beta Folders	10,387	92
4	Phyx 46 21	Go Science	10,325	89
5	Timo van&n... 71 1541	Void Crushers	10,324	85

Show all >

Need this puzzle? Log in to download.

Comments

Wed, 12/11/2019 - 23:28

#1

LociOiling's picture

Offline

Joined: 12/27/2012

Groups: Beta Folders

heartbraker

https://foldit.fandom.com/wiki/Revisiting_puzzle/83:_Cardiotoxin


	User login Username: * Password: * Create new account Request new password

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.


	Social Media


	Search Only search fold.it


	Click here to read Foldit's statement on the Black Lives Matter movement.


	Other Games: Mozak

Recommend Foldit


	Topics
	FOLDING TIME: How fast can a protein chain fold to its most stable structure? Office Hours Foldit Newsletters [survey] how would you feel if new tool was introduced for ED puzzles? 5-minute Covid+Foldit talk from Sci Foo (July 2021)


	Top New Users bumdayma ayashka12 LouisYuan alexandrabryan vanle2000

Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons