![]() |
1770: Electron Density Kinesin Coiled-Coil: Round 2
Status: Closed
|
Summary
Name: | 1770: Electron Density Kinesin Coiled-Coil: Round 2 |
---|---|
Status: | Closed |
Created: | 12/08/2019 |
Points: | 100 |
Expired: | 12/13/2019 - 23:00 |
Difficulty: | Intermediate |
Description: | Fold a kinesin protein into an electron density map! This is a follow-up to Puzzle 1767, now starting with the crystallographer's structure! Players may also load in their solutions from Puzzle 1767. Note that this puzzle will only be up for 5 days, and will expire on December 13.
This is a monomer unit of the crystal structure 6IGN, which represents the coiled-coil stalk portion of a kinesin protein. Kinesins are motor proteins that transport cargo within the cell, by "walking" along the cellular cytoskeleton. This particular crystal structure has a poor R-free value, meaning that some of the x-ray diffraction data is poorly explained by the crystallographer's structure. We are curious whether Foldit players can build a better structure into the electron density map! Sequence:
QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG
|
Categories: | Electron Density, Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
were these puzzles set in the wrong order?