puzzle picture
1770: Electron Density Kinesin Coiled-Coil: Round 2
Status: Closed

Summary

Name: 1770: Electron Density Kinesin Coiled-Coil: Round 2
Status: Closed
Created: 12/08/2019
Points: 100
Expired: 12/13/2019 - 23:00
Difficulty: Intermediate
Description: Fold a kinesin protein into an electron density map! This is a follow-up to Puzzle 1767, now starting with the crystallographer's structure! Players may also load in their solutions from Puzzle 1767. Note that this puzzle will only be up for 5 days, and will expire on December 13.

This is a monomer unit of the crystal structure 6IGN, which represents the coiled-coil stalk portion of a kinesin protein. Kinesins are motor proteins that transport cargo within the cell, by "walking" along the cellular cytoskeleton. This particular crystal structure has a poor R-free value, meaning that some of the x-ray diffraction data is poorly explained by the crystallographer's structure. We are curious whether Foldit players can build a better structure into the electron density map!

Sequence:
QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG
Categories: Electron Density, Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams14,279100
2Go Science14,27171
3Beta Folders14,26049
4Marvin's bunch14,23933
5L'Alliance Francophone14,22822

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

frood66's picture
User offline. Last seen 6 hours 6 sec ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
were these puzzles set in the

were these puzzles set in the wrong order?

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons