puzzle picture
1770: Electron Density Kinesin Coiled-Coil: Round 2
Status: Closed

Summary

Name: 1770: Electron Density Kinesin Coiled-Coil: Round 2
Status: Closed
Created: 12/08/2019
Points: 100
Expired: 12/13/2019 - 23:00
Difficulty: Intermediate
Description: Fold a kinesin protein into an electron density map! This is a follow-up to Puzzle 1767, now starting with the crystallographer's structure! Players may also load in their solutions from Puzzle 1767. Note that this puzzle will only be up for 5 days, and will expire on December 13.

This is a monomer unit of the crystal structure 6IGN, which represents the coiled-coil stalk portion of a kinesin protein. Kinesins are motor proteins that transport cargo within the cell, by "walking" along the cellular cytoskeleton. This particular crystal structure has a poor R-free value, meaning that some of the x-ray diffraction data is poorly explained by the crystallographer's structure. We are curious whether Foldit players can build a better structure into the electron density map!

Sequence:
QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG
Categories: Electron Density, Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams14,279100
2Go Science14,27171
3Beta Folders14,26049
4Marvin's bunch14,23933
5L'Alliance Francophone14,22822

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 09/20/2011
Groups: Marvin's bunch
were these puzzles set in the

were these puzzles set in the wrong order?

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons