puzzle picture
1767: Electron Density: Kinesin Coiled-Coil
Status: Closed

Groups

RankGroupScorePoints
1Anthropic Dreams14,270100
2Go Science14,26874
3Beta Folders14,25554
4Void Crushers14,22538
5L'Alliance Francophone14,22127
6Gargleblasters14,21918
7Contenders14,20512
8Marvin's bunch14,1918
9Hun-Magyar Csapat13,9535
10Team Schleswig-Holstein13,9173
11FoldIt@Netherlands13,9092
12Team New Zealand13,9001
13Russian team13,8681
14Hold My Beer13,7411
15Trinity Biology12,3381
16Italiani Al Lavoro9,7921
17BrownBiomolecular8,7271
18DSN @ Home01


Need this puzzle? Log in to download.  

Comments

frood66's picture
User offline. Last seen 22 hours 42 min ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
sequence

the above sequence given is not correct.

Aubade01's picture
User offline. Last seen 1 day 20 hours ago. Offline
Joined: 10/12/2013
Groups: None
Kinesin sequence

The sequence given is identical to the Ca Ion Binding Protein puzzle 1765
>>>>> Aubade00/01

beta_helix's picture
User offline. Last seen 19 hours 35 min ago. Offline
Joined: 05/09/2008
Groups: None
Nice catch!

Sorry about that, here is the correct sequence (updated in the description as well):

QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDEL
NQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons