1767: Electron Density: Kinesin Coiled-Coil

Status: Closed

Summary

Name:	1767: Electron Density: Kinesin Coiled-Coil
Status:	Closed
Created:	12/02/2019
Points:	100
Expired:	12/09/2019 - 23:00
Difficulty:	Advanced
Description:	Fold a kinesin protein into an electron density map! We are giving you a monomer unit of the crystal structure 6IGN, which represents the coiled-coil stalk portion of a kinesin protein. Kinesins are motor proteins that transport cargo within the cell, by "walking" along the cellular cytoskeleton. This particular crystal structure of has a poor R-free value, meaning that some of the x-ray diffraction data is poorly explained by the crystallographer's structure. We are curious whether Foldit players can build a better structure into the electron density map! Correct Sequence: QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYD QKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG
Categories:	Electron Density, Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Anthropic Dreams	14,270	100
2	Go Science	14,268	74
3	Beta Folders	14,255	54
4	Void Crushers	14,225	38
5	L'Alliance Francophone	14,221	27

Rank	Player	Group	Score	Points
1	Galaxie 1 2	Anthropic Dreams	14,270	100
2	NinjaGreg 24 18	Go Science	14,268	97
3	toshiue 18 64	Go Science	14,268	94
4	Bruno Kestemont 4 6	Go Science	14,267	90
5	ZeroLeak7 36 16	Go Science	14,267	87

Rank	Player	Group	Score	Points
1	ZeroLeak7 36 16	Go Science	14,268	100
2	Bruno Kestemont 4 6	Go Science	14,260	97
3	Galaxie 1 2	Anthropic Dreams	14,253	94
4	Susume 51 618	Anthropic Dreams	14,253	90
5	retiredmichael 51 1387	Beta Folders	14,253	87

Need this puzzle? Log in to download.

Wed, 12/04/2019 - 17:36

Offline

Joined: 09/20/2011

Groups: Marvin's bunch

sequence

the above sequence given is not correct.

Wed, 12/04/2019 - 21:54

Offline

Joined: 10/12/2013

Groups: None

Kinesin sequence

The sequence given is identical to the Ca Ion Binding Protein puzzle 1765
>>>>> Aubade00/01

Wed, 12/04/2019 - 22:30

Offline

Joined: 05/09/2008

Groups: None

Nice catch!

Sorry about that, here is the correct sequence (updated in the description as well):

QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDEL
NQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG


	User login Username: * Password: * Create new account Request new password

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)


	Click here to read Foldit's statement on the Black Lives Matter movement.

Recommend Foldit


	Topics
	Foldit Newsletters We should make a science-y UI mod :DD for foldit RNA prediction through AI Office Hours Happy few Gold players in History


	Top New Users galbraith Goosneck Benjamin_F Bel Gomito naniewoo