puzzle picture
1767: Electron Density: Kinesin Coiled-Coil
Status: Closed

Summary

Name: 1767: Electron Density: Kinesin Coiled-Coil
Status: Closed
Created: 12/02/2019
Points: 100
Expired: 12/09/2019 - 23:00
Difficulty: Advanced
Description: Fold a kinesin protein into an electron density map! We are giving you a monomer unit of the crystal structure 6IGN, which represents the coiled-coil stalk portion of a kinesin protein. Kinesins are motor proteins that transport cargo within the cell, by "walking" along the cellular cytoskeleton. This particular crystal structure of has a poor R-free value, meaning that some of the x-ray diffraction data is poorly explained by the crystallographer's structure. We are curious whether Foldit players can build a better structure into the electron density map!

Correct Sequence:
QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYD QKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG
Categories: Electron Density, Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams14,270100
2Go Science14,26874
3Beta Folders14,25554
4Void Crushers14,22538
5L'Alliance Francophone14,22127

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 09/20/2011
Groups: Marvin's bunch
sequence

the above sequence given is not correct.

Aubade01's picture
User offline. Last seen 1 day 17 hours ago. Offline
Joined: 10/12/2013
Groups: None
Kinesin sequence

The sequence given is identical to the Ca Ion Binding Protein puzzle 1765
>>>>> Aubade00/01

Joined: 05/09/2008
Groups: None
Nice catch!

Sorry about that, here is the correct sequence (updated in the description as well):

QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDEL
NQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons