1767: Electron Density: Kinesin Coiled-Coil

Status: Closed

Summary

Name:	1767: Electron Density: Kinesin Coiled-Coil
Status:	Closed
Created:	12/02/2019
Points:	100
Expired:	12/09/2019 - 23:00
Difficulty:	Advanced
Description:	Fold a kinesin protein into an electron density map! We are giving you a monomer unit of the crystal structure 6IGN, which represents the coiled-coil stalk portion of a kinesin protein. Kinesins are motor proteins that transport cargo within the cell, by "walking" along the cellular cytoskeleton. This particular crystal structure of has a poor R-free value, meaning that some of the x-ray diffraction data is poorly explained by the crystallographer's structure. We are curious whether Foldit players can build a better structure into the electron density map! Correct Sequence: QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYD QKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG
Categories:	Electron Density, Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Anthropic Dreams	14,270	100
2	Go Science	14,268	74
3	Beta Folders	14,255	54
4	Void Crushers	14,225	38
5	L'Alliance Francophone	14,221	27

Rank	Player	Group	Score	Points
1	Galaxie 6 9	Anthropic Dreams	14,270	100
2	NinjaGreg 24 19	Go Science	14,268	97
3	toshiue 13 222	Go Science	14,268	94
4	Bruno Kestemont 2 8	Go Science	14,267	90
5	ZeroLeak7 22 1	Go Science	14,267	87

Rank	Player	Group	Score	Points
1	ZeroLeak7 22 1	Go Science	14,268	100
2	Bruno Kestemont 2 8	Go Science	14,260	97
3	Galaxie 6 9	Anthropic Dreams	14,253	94
4	Susume 89 316	Anthropic Dreams	14,253	90
5	retiredmichael 91 1639	Beta Folders	14,253	87

Need this puzzle? Log in to download.

Wed, 12/04/2019 - 17:36

Offline

Joined: 09/20/2011

Groups: Marvin's bunch

sequence

the above sequence given is not correct.

Wed, 12/04/2019 - 21:54

Offline

Joined: 10/12/2013

Groups: None

Kinesin sequence

The sequence given is identical to the Ca Ion Binding Protein puzzle 1765
>>>>> Aubade00/01

Wed, 12/04/2019 - 22:30

Offline

Joined: 05/09/2008

Groups: None

Nice catch!

Sorry about that, here is the correct sequence (updated in the description as well):

QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDEL
NQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG


	User login Username: * Password: * Create new account Request new password

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)


	Click here to read Foldit's statement on the Black Lives Matter movement.

Recommend Foldit


	Topics
	Which is the best PHP Live Training Institute in Chandigarh How to Foldit Office Hours Found a back door for spammers. GUI going away


	Top New Users fuoco BLU2117 ManuelGK Kyr4aviu Zymkaz