|
|
|
1767: Electron Density: Kinesin Coiled-Coil
Status: Closed
|
Summary
Name: |
1767: Electron Density: Kinesin Coiled-Coil |
Status: |
Closed |
Created: |
12/02/2019 |
Points: |
100 |
Expired: |
12/09/2019 - 23:00 |
Difficulty: |
Advanced |
Description: |
Fold a kinesin protein into an electron density map! We are giving you a monomer unit of the crystal structure 6IGN, which represents the coiled-coil stalk portion of a kinesin protein. Kinesins are motor proteins that transport cargo within the cell, by "walking" along the cellular cytoskeleton. This particular crystal structure of has a poor R-free value, meaning that some of the x-ray diffraction data is poorly explained by the crystallographer's structure. We are curious whether Foldit players can build a better structure into the electron density map!
Correct Sequence:
QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYD
QKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG
|
Categories: | Electron Density, Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
Comments
|
|
|
|
|
|
|
|
|
|
|
|
the above sequence given is not correct.