puzzle picture
1765: Revisiting Puzzle 81: Calcium Ion Binding Protein
Status: Closed

Summary

Name: 1765: Revisiting Puzzle 81: Calcium Ion Binding Protein
Status: Closed
Created: 11/26/2019
Points: 100
Expired: 12/04/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,819100
2Go Science10,78174
3Gargleblasters10,72054
4L'Alliance Francophone10,60538
5Anthropic Dreams10,55627

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons