puzzle picture
1760b: Unsolved De-novo Freestyle 157: Symmetric Trimer
Status: Closed

Summary

Name: 1760b: Unsolved De-novo Freestyle 157: Symmetric Trimer
Status: Closed
Created: 11/14/2019
Points: 100
Expired: 11/21/2019 - 23:00
Difficulty: Intermediate
Description: Note: This puzzle replaces Puzzle 1760, which was mistakenly posted with the wrong sequence.

This is a follow-up to Puzzle 1757: De-novo Freestyle 157, now with C3 symmetry. This protein was originally designed by a Foldit player as a symmetric trimer. In Puzzle 1757, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C3 symmetry. Players may load in solutions from Puzzle 1757. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS
Categories: Overall, Prediction, Symmetry

Top Groups

RankGroupScorePoints
1Anthropic Dreams13,736100
2Beta Folders13,63473
3Go Science13,47352
4Void Crushers13,41536
5Hold My Beer13,25724

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons