puzzle picture
1750: Revisiting Puzzle 75: Antifreeze Protein
Status: Closed

Summary

Name: 1750: Revisiting Puzzle 75: Antifreeze Protein
Status: Closed
Created: 10/22/2019
Points: 100
Expired: 10/30/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science10,176100
2Void Crushers10,14373
3Hun-Magyar Csapat10,12952
4Anthropic Dreams10,12836
5L'Alliance Francophone10,11624

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 6 hours 39 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
the pout pout fish
Joined: 03/30/2013
Groups: Go Science
Puzzle scores

This puzzle closed almost two days ago. No points are showing as having been awarded. Is anyone looking at this problem?

Joined: 03/30/2013
Groups: Go Science
Puzzle scores

This puzzle closed almost two days ago. No points are showing as having been awarded. Is anyone looking at this problem?

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons