puzzle picture
1747: Revisiting Puzzle 74: Platypus Venom
Status: Closed

Summary

Name: 1747: Revisiting Puzzle 74: Platypus Venom
Status: Closed
Created: 10/15/2019
Points: 100
Expired: 10/23/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders9,735100
2Marvin's bunch9,71870
3Anthropic Dreams9,67547
4Hun-Magyar Csapat9,66830
5Go Science9,65619

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1retiredmichael 12 3 Beta Folders9,721100
2LociOiling 2 1 Beta Folders9,71096
3johnmitch 81 7  9,70192
4dcrwheeler 81 6  9,68988
5frood66 59 20 Marvin's bunch9,67684


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 3 hours 8 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
monotreme extreme
LociOiling's picture
User offline. Last seen 3 hours 8 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
scoreboards down?

I'm still not seeing scoreboards in the client after about 12 hours. Other users are reporting the same thing.

bkoep's picture
User offline. Last seen 8 hours 52 min ago. Offline
Joined: 11/15/2012
Groups: None
Looking into this

Stay tuned...

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons