![]() |
1731: Revisiting Puzzle 70: Nucleosome Protein
Status: Closed
|
Summary
Name: | 1731: Revisiting Puzzle 70: Nucleosome Protein |
---|---|
Status: | Closed |
Created: | 09/15/2019 |
Points: | 100 |
Expired: | 09/23/2019 - 18:00 |
Difficulty: | Novice |
Description: | This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
https://foldit.fandom.com/wiki/Revisiting_puzzle/70:_Nucleosome_Protein