puzzle picture
1731: Revisiting Puzzle 70: Nucleosome Protein
Status: Closed

Summary

Name: 1731: Revisiting Puzzle 70: Nucleosome Protein
Status: Closed
Created: 09/15/2019
Points: 100
Expired: 09/23/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science10,892100
2Anthropic Dreams10,85177
3Beta Folders10,84358
4Marvin's bunch10,78843
5Void Crushers10,75431

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1dcrwheeler 103 10  10,896100
2Bruno Kestemont 2 4 Go Science10,89296
3RockOn 62 111  10,83992
4retiredmichael 103 2473 Beta Folders10,82885
5ZeroLeak7 52 21 Go Science10,80881


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 47 min 20 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
the mighty mighty histones
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons