puzzle picture
1731: Revisiting Puzzle 70: Nucleosome Protein
Status: Closed

Summary

Name: 1731: Revisiting Puzzle 70: Nucleosome Protein
Status: Closed
Created: 09/15/2019
Points: 100
Expired: 09/23/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science10,892100
2Anthropic Dreams10,85177
3Beta Folders10,84358
4Marvin's bunch10,78843
5Void Crushers10,75431

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1dcrwheeler 82 6  10,896100
2Bruno Kestemont 3 5 Go Science10,89296
3RockOn 82 50  10,83992
4Waya 9 11 Anthropic Dreams10,83188
5retiredmichael 12 2 Beta Folders10,82885


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 6 hours 57 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
the mighty mighty histones
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons