puzzle picture
1727: Revisiting Puzzle 69: Scorpion Toxin
Status: Closed

Summary

Name: 1727: Revisiting Puzzle 69: Scorpion Toxin
Status: Closed
Created: 09/09/2019
Points: 100
Expired: 09/16/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Marvin's bunch10,992100
2Beta Folders10,98971
3Void Crushers10,91549
4Anthropic Dreams10,80633
5Hun-Magyar Csapat10,79022

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 5 hours 41 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
mostly harmless?
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons