puzzle picture
1724: Revisiting Puzzle 68: Bos Taurus
Status: Closed

Summary

Name: 1724: Revisiting Puzzle 68: Bos Taurus
Status: Closed
Created: 09/01/2019
Points: 100
Expired: 09/09/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Hun-Magyar Csapat10,728100
2Beta Folders10,71870
3Go Science10,69547
4L'Alliance Francophone10,64330
5Anthropic Dreams10,63219

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 7 hours 22 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
no bs
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons