puzzle picture
1716: Revisiting Puzzle 66: Cytochrome
Status: Closed

Summary

Name: 1716: Revisiting Puzzle 66: Cytochrome
Status: Closed
Created: 08/19/2019
Points: 100
Expired: 08/26/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science10,238100
2Anthropic Dreams10,22970
3Contenders10,21947
4Beta Folders10,21630
5Marvin's bunch10,20919

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1RockOn 63 111  10,361100
2Bruno Kestemont 2 3 Go Science10,23896
3NinjaGreg 32 12 Go Science10,22492
4Phyx 50 14 Go Science10,22288
5crpainter 102 2482 Contenders10,21984


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 55 min 17 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also:
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons