puzzle picture
1702: Revisiting Puzzle 61: Designer Protein Top7
Status: Closed

Summary

Name: 1702: Revisiting Puzzle 61: Designer Protein Top7
Status: Closed
Created: 07/22/2019
Points: 100
Expired: 07/29/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Gargleblasters11,749100
2Go Science11,73170
3Beta Folders11,72947
4Marvin's bunch11,68430
5Anthropic Dreams11,66919

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 5 hours 50 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
see also:
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons