puzzle picture
1699: Revisiting Puzzle 60: Beta Barrel
Status: Closed

Summary

Name: 1699: Revisiting Puzzle 60: Beta Barrel
Status: Closed
Created: 07/15/2019
Points: 100
Expired: 07/22/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
26GUGITBIOTECH10,9731
27Team South Africa10,1751
28QCNMIT10,0081
29DU CHEM 3705 Winter 20194,5131

Top Evolvers

RankPlayerGroupScorePoints
26Anfinsen_slept_here 20 47 Go Science12,06153
27Blipperman 26 31 Gargleblasters11,81351

Top Soloists

RankPlayerGroupScorePoints
26Merf 74 74  12,12936
27diamonddays 74 520  12,09434
28Anfinsen_slept_here 20 47 Go Science12,08633
29silent gene 24 93 Go Science12,05130
30O Seki To 67 289 Hun-Magyar Csapat12,05128


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 2 hours 31 min ago. Offline
Joined: 12/27/2012
Roll out the barrel...
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons